Elysabeth Alfano

  • About
  • Podcast
  • Radio/TV
  • Events
  • Recipes
  • Press
  • Contact
FacebookTwitterInstagramLinkedinYoutubeVk
Elysabeth Alfano
  • Home
  • Author Elysabeth Alfano

Banana Oatmeal Pumpkin Coconut Carrot Raisin Muffins

Elysabeth AlfanoFebruary 15, 2019February 15, 2019
awesomebakebananacarrotcoconuteasyfastfruitsgoodhealthyheartlovemuffinno butterno flourno sugaroatspumpkinrasintastytinvalentinesveganvegetablesveggiesyummy

Stephen Wells – Lead Hero at the Animal Legal Defense Fund

Elysabeth AlfanoFebruary 13, 2019
ALDFanimalanimal legal defense fundbellabillbillscompassioncruelcrueltydogfactoriesfarmedharmhorsejusticelawlawslawyerlovestephenunlawfulwells

Silver Hair Is Sexy

Elysabeth AlfanoFebruary 6, 2019
carly hendersoncolordocumentarydyegoing graygraygray hairgray is the new blondegreyhairhaircolorharsh chemicalshealthylifelifesylelushtelevisionvictoria mariewciu

Vegan SUPER BOWL Chili

Elysabeth AlfanoJanuary 31, 2019February 4, 2019
bar foodbeerchilicomfort foodelysabeth alfanogronkhome cookingla ramsparty foodpatriotsplantbasedpub grubrob gronkowskisilver chic chefspicysuper bowltom bradyvegan

Rachel Barton Pine: Rockin’ Violinist and Vegan

Elysabeth AlfanoJanuary 30, 2019February 6, 2019
bartonchildrenclassicalkidmothermusicpineplantbasedpodcastrachelrbprockveganviolin

The Game Changers

Elysabeth AlfanoJanuary 27, 2019January 28, 2019
arnold Schwarzeneggerathletedamien manderfilmjames cameronJames wilkslightninglou smithlouie psihoyosmachomanmanlymenmovieNFLPatrik baboumianplantbasedstrongmanThe Game Changersvegan

Asparagus, Purple Potato, Zucchini Casserole

Elysabeth AlfanoJanuary 25, 2019January 28, 2019
asparagusawesome veganscasserolecookingdinner partyelysabeth alfanokitchenplant-basedplantbasedpurple potatorecipeveganzucchini

Veggie Protein Packed Meatloaf

Elysabeth AlfanoJanuary 16, 2019February 3, 2019
celerychefcookingheartylentilsmanly mealmealmeatmeatloafmushroomsonionsplant-basedplantbasedproteinquinoasuper bowltempehtomatoevegan

Fig Eggplant Pizza

Elysabeth AlfanoJanuary 15, 2019January 26, 2019
arugulabalsamiceggplantfigonionspine nutspizzavegan fetavineager

Dr. Neal Barnard

Elysabeth AlfanoJanuary 15, 2019January 15, 2019
animal testingdietdoctorsdr. neal barnardelysabeth alfanohealthynew years resolutionPhysician’s committee for responsible medicineplant-basedplantbasedveganvegan starter kitveganuary

Posts navigation

1 2 … 7

Site Navigation

  • Awesome Vegans Podcast & Vlog
  • The Dinner Party
  • Speaking/Merch
  • Recipes
  • Radio/TV
  • Meal Planner
  • Aging Backwards

Shop

  • Subscribe for free on Apple Podcasts
  • Subscribe for free on YouTube
  • Shop at Amazon
  • Tshirts
  • Mugs
  • E-Cookbook
  • Donate
  • Download the app

Contact

  • Contact
  • About Elysabeth
  • Press
  • Facebook
  • iTunes
  • Instagram
  • Linkedin
  • Twitter
  • Youtube
@2018 - elysabethalfano.com. All Right Reserved.
Elysabeth Alfano
FacebookTwitterInstagramLinkedinYoutubeVk
  • About
  • Podcast
  • Radio/TV
  • Events
  • Recipes
  • Press
  • Contact